PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thecc1EG022574t2
Common NameTCM_022574
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae; Theobroma
Family bZIP
Protein Properties Length: 419aa    MW: 46056.6 Da    PI: 7.9925
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thecc1EG022574t2genomeCGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_146.11.1e-14333384556
                       CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
            bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkev 56 
                       +r+rr++kNRe+A rsR+RK+a++ eLe + ++L++eN  Lk+ leel  + 
  Thecc1EG022574t2 333 RRQRRMIKNRESAARSRARKQAYTVELEAELDQLKQENAHLKQALEELDRKR 384
                       79*******************************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003381.2E-13329393IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.783331383IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1709.4E-15333386No hitNo description
SuperFamilySSF579595.94E-11333383No hitNo description
PfamPF001704.4E-13333385IPR004827Basic-leucine zipper domain
CDDcd147078.53E-24333387No hitNo description
PROSITE patternPS000360336351IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009409Biological Processresponse to cold
GO:0009414Biological Processresponse to water deprivation
GO:0009651Biological Processresponse to salt stress
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0010152Biological Processpollen maturation
GO:0010187Biological Processnegative regulation of seed germination
GO:0010200Biological Processresponse to chitin
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048316Biological Processseed development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 419 aa     Download sequence    Send to blast
MVITESEIGE VESSLQVDQQ QKNHPFSSLG RQSSIYSLTL DEFQHTVCED GKNFGSMNMD  60
EFITSIWNAE ENQAINSNIY NQQSNCANKQ VSSYVHLSLN ETTSNNGIAK QPSLPRQGSL  120
TLPAPLCRKT VDEVWSEMHK GQQGQGQSNN SNVENAENGT RQPTFGEMTL EDFLIKAGVR  180
EQCMLPAPPP QHQPQYGLYQ SGNNAAGGPG FVSRPIMGVD SKGGFGGSAY QTMPPGGVIG  240
DSSGYVNDCK RGSGYQPTAP PPTTVCYSGK VAAAGAYVRG QAMGVVSPMS PVSSEGMCNS  300
QVDNAANHFG MDMGGLRGRK RIIEGPIEKV VERRQRRMIK NRESAARSRA RKQAYTVELE  360
AELDQLKQEN AHLKQALEEL DRKRKQQYFE ERKMITQTEA QKAKEKLRII RRNLSCPL*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00294DAPTransfer from AT2G36270Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007027722.10.0Basic-leucine zipper transcription factor family protein, putative isoform 1
RefseqXP_007027723.10.0Basic-leucine zipper transcription factor family protein, putative isoform 1
SwissprotQ9SJN01e-123ABI5_ARATH; Protein ABSCISIC ACID-INSENSITIVE 5
TrEMBLA0A061F1560.0A0A061F156_THECC; Basic-leucine zipper transcription factor family protein, putative isoform 1
STRINGVIT_08s0007g03420.t011e-147(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G36270.11e-113bZIP family protein
Publications ? help Back to Top
  1. Motamayor JC, et al.
    The genome sequence of the most widely cultivated cacao type and its use to identify candidate genes regulating pod color.
    Genome Biol., 2013. 14(6): p. r53
    [PMID:23731509]